EnglishEspañolFrançaisDeutschItalianoPortuguêsРусский日本語한국어العربيةहिन्दीTürkçe
🔍

Step by step

adverb

Definitions

1.adverbFrom one stage to the next in sequence.
"We were shown the process step by step."
2.adverbGradually and steadily.

Synonyms

bit by bitlittle by littlein orderstep by stepstepwisegraduallystepmealsteplystepwiselysequentiallyone step at a timeprogressively
🔗 Find words with "step by step" in A2Z Word Finder
The Daily Word NerdA new word, a puzzle, and a fun fact — free in your inbox every morning.
Free forever · unsubscribe anytime · all 14 newsletters
That email did not go through — please check it and try again.