EnglishEspañolFrançaisDeutschItalianoPortuguêsРусский日本語한국어العربيةहिन्दीTürkçe
🔍

Smiley

noun
/ˈsmaɪli/
Word Frequency: 0.6

Definitions

1.nounA simplified representation of a smiling face.
2.nounA sequence of keyboard characters used to represent a happy mood, especially :) or :-) or other depiction of smiling.
3.nounAn improvised street weapon consisting of a length of chain with padlocks and other heavy objects affixed to one end.
4.nounA roasted sheep's head.
5.nounThe type of piercing of the upper frenulum (upper lip).
6.adjectiveCheerful and happy; smiling.
7.adjectiveHaving one's throat slit from side to side.

Synonyms

emoticonsmiley facemerrycheerfulhappyexpensivefacesidecara-happysidedsmily

Rhymes With

wilywrylyslylydrylydrilyvilelyshilyshyly
🔗 Find words with "smiley" in A2Z Word Finder
The Daily Word NerdA new word, a puzzle, and a fun fact — free in your inbox every morning.
Free forever · unsubscribe anytime · all 14 newsletters
That email did not go through — please check it and try again.