EnglishEspañolFrançaisDeutschItalianoPortuguêsРусский日本語한국어العربيةहिन्दीTürkçe
🔍

Inner marker

Noun

Definitions

1.NounA type of marker beacon placed to indicate when an aircraft crosses the runway threshold of a Category II or Category III ILS or IGS approach, triggering a continuous visual and aural sequence of rapid-fire Morse code dots from the marker beacon receiver in the cockpit of an aircraft flying over the marker.

Synonyms

middle markerairmarkermarkerwaymarkerflagmarkcue marknon-manual markeriteration markindicatorlateral markdiscourse marker
🔗 Find words with "inner marker" in A2Z Word Finder
The Daily Word NerdA new word, a puzzle, and a fun fact — free in your inbox every morning.
Free forever · unsubscribe anytime · all 14 newsletters
That email did not go through — please check it and try again.