EnglishEspañolFrançaisDeutschItalianoPortuguêsРусский日本語한국어العربيةहिन्दीTürkçe
🔍

Heavy

noun
/ˈhe.vi/
Word Frequency: 59.4

Definitions

1.nounA villain or bad guy; the one responsible for evil or aggressive acts.
"With his wrinkled, uneven face, the actor always seemed to play the heavy in films."
2.nounA doorman, bouncer or bodyguard.
"A fight started outside the bar but the heavies came out and stopped it."
3.nounA large multi-engined aircraft. (The term heavy normally follows the call-sign when used by air traffic controllers.)
4.verb(often with "up") To make heavier.
5.verbTo sadden.
6.verbTo use power and/or wealth to exert influence on, e.g., governments or corporations; to pressure.
"The union was well known for the methods it used to heavy many businesses."
7.adjective(of a physical object) Having great weight.
8.adjective(of a topic) Serious, somber.
9.adjectiveNot easy to bear; burdensome; oppressive.
"heavy yokes, expenses, undertakings, trials, news, etc."
10.adjectiveGood.
"This film is heavy."
11.adjective(late 1960s, 1970s) Profound.
"The Moody Blues are, like, heavy."
12.adjective(of a rate of flow) High, great.
13.adjectiveArmed.
"Come heavy, or not at all."
14.adjectiveLouder, more distorted.
"Metal is heavier than swing."
15.adjective(of weather) Hot and humid.
16.adjective(of a person) Doing the specified activity more intensely than most other people.
"He was a heavy sleeper, a heavy eater and a heavy smoker – certainly not an ideal husband."
17.adjective(of food) High in fat or protein; difficult to digest.
"Cheese-stuffed sausage is too heavy to eat before exercising."
18.adjectiveOf great force, power, or intensity; deep or intense.
"it was a heavy storm;  a heavy slumber in bed;  a heavy punch"
19.adjectiveLaden to a great extent.
"his eyes were heavy with sleep;  she was heavy with child"
20.adjectiveLaden with that which is weighty; encumbered; burdened; bowed down, either with an actual burden, or with grief, pain, disappointment, etc.
21.adjectiveSlow; sluggish; inactive; or lifeless, dull, inanimate, stupid.
"a heavy gait, looks, manners, style, etc."
22.adjectiveImpeding motion; cloggy; clayey.
"a heavy road; a heavy soil"
23.adjectiveNot raised or leavened.
"heavy bread"
24.adjective(of wines or spirits) Having much body or strength.
25.adjectiveWith child; pregnant.
26.adjectiveContaining one or more isotopes that are heavier than the normal one
27.adjective(petroleum) with high viscosity
28.adverbIn a heavy manner; weightily; heavily; gravely.
"heavy laden with their sins"
29.adverbTo a great degree; greatly.
30.adverbVery

Synonyms

swearsweerweightyheavilyheftyponderousheavyweightmassivebiglargegreatdense

Antonyms

light

Rhymes With

leveebevylevychevybevvycapital levybrevitevye
🔗 Find words with "heavy" in A2Z Word Finder
The Daily Word NerdA new word, a puzzle, and a fun fact — free in your inbox every morning.
Free forever · unsubscribe anytime · all 14 newsletters
That email did not go through — please check it and try again.