EnglishEspañolFrançaisDeutschItalianoPortuguêsРусский日本語한국어العربيةहिन्दीTürkçe
🔍

Affinity

noun
/əˈfɪnɪti/
Word Frequency: 7.4

Definitions

1.nounA natural attraction or feeling of kinship to a person or thing.
2.nounA family relationship through marriage of a relative (e.g. sister-in-law), as opposed to consanguinity (e.g. sister).
3.nounA kinsman or kinswoman of a such relationship; one who is affinal.
4.nounThe fact of and manner in which something is related to another.
5.nounAny romantic relationship.
6.nounAny passionate love for something.
7.nounResemblances between biological populations; resemblances that suggest that they are of a common origin, type or stock.
8.nounStructural resemblances between minerals; resemblances that suggest that they are of a common origin or type.
9.nounAn attractive force between atoms, or groups of atoms, that contributes towards their forming bonds
10.nounThe attraction between an antibody and an antigen
11.nounTendency to keep a task running on the same processor in a symmetric multiprocessing operating system to reduce the frequency of cache misses
12.nounAn automorphism of affine space.

Synonyms

kinshipchemical attractionkinship by marriagephylogenetic relationloveaffectionfondnesspenchantsympathymarriagecommonalityrelatedness

Rhymes With

divinityvicinityinfinityvirginityfemininityalkalinitymasculinitysalinity
🔗 Find words with "affinity" in A2Z Word Finder
The Daily Word NerdA new word, a puzzle, and a fun fact — free in your inbox every morning.
Free forever · unsubscribe anytime · all 14 newsletters
That email did not go through — please check it and try again.